Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGFL1 protein

This Human IGFL1 protein spans the amino acid sequence from region 25-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGFL1, UNQ644/PRO1274, Insulin growth factor-like family member 1

UniProt

Q6UW32

Expression Region

25-110aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCKAP1L Protein Vector (Rat) (pPM-C-HA)
31558026 500 ng

NCKAP1L Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 18 Antibody (KRT18/7056R) [Janelia Fluor 585]
NBP3-20912JF585 0.1 mL

Rabbit Monoclonal Cytokeratin 18 Antibody (KRT18/7056R) [Janelia Fluor 585]

Sign In for Pricing
View Details
Lentiviral mouse Egfem1 shRNA (UAS) - Lentiviral mouse Egfem1 shRNA (UAS, iRFP) (25)
GTR15195002 1 Vial

Lentiviral mouse Egfem1 shRNA (UAS) - Lentiviral mouse Egfem1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
POu2AF1, 1-256aa, Human, His tag, E Coli
MBS204714-01 0.01 mg

POu2AF1, 1-256aa, Human, His tag, E Coli

Sign In for Pricing
View Details
POu2AF1, 1-256aa, Human, His tag, E Coli
MBS204714-02 0.05 mg

POu2AF1, 1-256aa, Human, His tag, E Coli

Sign In for Pricing
View Details
POu2AF1, 1-256aa, Human, His tag, E Coli
MBS204714-03 5x 0.01 mg

POu2AF1, 1-256aa, Human, His tag, E Coli

Sign In for Pricing
View Details