Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus ULP1 protein

This Virus ULP1 protein spans the amino acid sequence from region 403-621aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ULP1, YPL020C, LPB11C, Ubiquitin-like-specific protease 1, EC 3.4.22.68

UniProt

Q02724

Expression Region

403-621aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Interleukin-23/IL-23 (C-6His)
32-9457-50 50 µg

Recombinant Mouse Interleukin-23/IL-23 (C-6His)

Sign In for Pricing
View Details
Breast cancer type 1 susceptibility protein homolog
orb1643555-01 50 µg

Breast cancer type 1 susceptibility protein homolog

Sign In for Pricing
View Details
Breast cancer type 1 susceptibility protein homolog
orb1643555-02 100 µg

Breast cancer type 1 susceptibility protein homolog

Sign In for Pricing
View Details
Breast cancer type 1 susceptibility protein homolog
orb1643555-03 1 mg

Breast cancer type 1 susceptibility protein homolog

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF563 Antibody
NBP2-86518-0.1mL 0.1 mL

Rabbit Polyclonal ZNF563 Antibody

Sign In for Pricing
View Details
MILK2 (C-term) Rabbit pAb
E2615395 100 µL

MILK2 (C-term) Rabbit pAb

Sign In for Pricing
View Details