Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus ULP1 protein

This Virus ULP1 protein spans the amino acid sequence from region 403-621aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ULP1, YPL020C, LPB11C, Ubiquitin-like-specific protease 1, EC 3.4.22.68

UniProt

Q02724

Expression Region

403-621aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas Salmonicida argH Protein
VAng-Lsx1244-500gEcoli 500 µg (E. coli)

Recombinant Aeromonas Salmonicida argH Protein

Sign In for Pricing
View Details
GRK 5 Lentiviral Activation Particles (h2)
sc-401285-LAC-2 200 µL

GRK 5 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Mouse Monoclonal Podoplanin Antibody (PDPN/1433) [Janelia Fluor 549]
NBP2-54347JF549 0.1 mL

Mouse Monoclonal Podoplanin Antibody (PDPN/1433) [Janelia Fluor 549]

Sign In for Pricing
View Details
GLRX Recombinant Protein
OPCD03582-50UG 50 µg

GLRX Recombinant Protein

Sign In for Pricing
View Details
Compound Fr16644
orb3170266-01 1 mg

Compound Fr16644

Sign In for Pricing
View Details
Compound Fr16644
orb3170266-02 5 mg

Compound Fr16644

Sign In for Pricing
View Details