Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Phb protein

This Mouse Phb protein spans the amino acid sequence from region 41-173aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 32 (BAP 32)

UniProt

P67778

Expression Region

41-173aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Troponin T Type 2, Cardiac
550414 200 µL

Troponin T Type 2, Cardiac

Sign In for Pricing
View Details
PSENEN Antibody (FITC)
orb687274-01 50 μL

PSENEN Antibody (FITC)

Sign In for Pricing
View Details
PSENEN Antibody (FITC)
orb687274-02 100 µL

PSENEN Antibody (FITC)

Sign In for Pricing
View Details
LCN2 Antibody
orb3161717-01 50 µL

LCN2 Antibody

Sign In for Pricing
View Details
LCN2 Antibody
orb3161717-02 100 µL

LCN2 Antibody

Sign In for Pricing
View Details
ELISA Kit for P-Selectin (SELP)
TRV-0047914-01 24 Tests

ELISA Kit for P-Selectin (SELP)

Sign In for Pricing
View Details