Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria mazF protein

This Bacteria mazF protein spans the amino acid sequence from region 1-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Toxin MazF (mRNA interferase MazF)

UniProt

Q9F7V5

Expression Region

1-120aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus epidermidis

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP6 (NM_001718) Human Recombinant Protein
TP312307M 100 µg

BMP6 (NM_001718) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human FGF18 shRNA (UAS) - Lentiviral human FGF18 shRNA (UAS, iRFP) (100)
GTR15339594 1 Vial

Lentiviral human FGF18 shRNA (UAS) - Lentiviral human FGF18 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mouse Monoclonal EGFR Antibody (DH8.3) [Alexa Fluor 532]
NBP2-50599AF532 0.1 mL

Mouse Monoclonal EGFR Antibody (DH8.3) [Alexa Fluor 532]

Sign In for Pricing
View Details
ASSP6 siRNA Oligos set (Human)
53062171 3x 5 nmol

ASSP6 siRNA Oligos set (Human)

Sign In for Pricing
View Details
CDC14B Rabbit Polyclonal Antibody (Cy7)
orb1039913 100 µL

CDC14B Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
HNRNPL Antibody
orb685498 100 µL

HNRNPL Antibody

Sign In for Pricing
View Details