Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria mazF protein

This Bacteria mazF protein spans the amino acid sequence from region 1-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Toxin MazF (mRNA interferase MazF)

UniProt

Q9F7V5

Expression Region

1-120aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus epidermidis

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Label Cartridge Freezerbondz B-490 Black on White 38.1mm x 98.42mm
LAB4530 1 Each

Label Cartridge Freezerbondz B-490 Black on White 38.1mm x 98.42mm

Sign In for Pricing
View Details
Easypro Rat Deoxyribonuclease I (DNASE1) ELISA Kit
FY-ER3383S 96 Well

Easypro Rat Deoxyribonuclease I (DNASE1) ELISA Kit

Sign In for Pricing
View Details
STX4 Polyclonal Conjugated Antibody
MBS9441701-01 0.1 mL (Biotin)

STX4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
STX4 Polyclonal Conjugated Antibody
MBS9441701-02 0.1 mL (AF350)

STX4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
STX4 Polyclonal Conjugated Antibody
MBS9441701-03 0.1 mL (AF405)

STX4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
STX4 Polyclonal Conjugated Antibody
MBS9441701-04 0.1 mL (AF488)

STX4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details