Animal RPS13 protein
This Animal RPS13 protein spans the amino acid sequence from region 2-151aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
RPS13, 40S ribosomal protein S13
UniProt
Q8I7D6
Expression Region
2-151aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
23.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GRMHAPGKGLSSSALPYRRSVPTWLKLSSEDVKEQIYKLAKKGLRPSQIGVILRDSHGSAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAMRKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472554-100 1x 100 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![GATA1 Recombinant Rabbit Monoclonal Antibody [JA10-32]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81079/imageurl/et1704-41.webp)
ET1704-41 100 µL
GATA1 Recombinant Rabbit Monoclonal Antibody [JA10-32]
Sign In for Pricing
View Details ![PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI10E7]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907da3/imageurl/cf805726.webp)
CF805726 100 µg
PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI10E7]
Sign In for Pricing
View Details 