Human FCN3 protein
This Human FCN3 protein spans the amino acid sequence from region 24-299aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen FCNH, HAKA1
UniProt
O75636
Expression Region
24-299aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-A790273-50MG 50 mg
(S)-2-((S)-2-Amino-4-carboxybutanamido)pentanedioic Acid
Sign In for Pricing
View Details ![FAM134B Recombinant Rabbit Monoclonal Antibody [PSH01-94]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80f97/imageurl/ha721752.webp)
HA721752 100 µL
FAM134B Recombinant Rabbit Monoclonal Antibody [PSH01-94]
Sign In for Pricing
View Details 
RA-2358-2 2 mL
TRITC Conjugated Rabbit Polyclonal Antibody to Guinea Pig IgG
Sign In for Pricing
View Details 
BNUB2030-100 1x 100 µL
Catenin, beta (CTNNB1) (CTNNB1/2030R), 0.2mg/mL
Sign In for Pricing
View Details