Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCN3 protein

This Human FCN3 protein spans the amino acid sequence from region 24-299aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen FCNH, HAKA1

UniProt

O75636

Expression Region

24-299aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Estrogen Receptor alpha (phospho S118) Antibody
RC-16707-01 50 μL

Recombinant Estrogen Receptor alpha (phospho S118) Antibody

Sign In for Pricing
View Details
Recombinant Estrogen Receptor alpha (phospho S118) Antibody
RC-16707-02 100 µL

Recombinant Estrogen Receptor alpha (phospho S118) Antibody

Sign In for Pricing
View Details
Recombinant Estrogen Receptor alpha (phospho S118) Antibody
RC-16707-03 1 mL

Recombinant Estrogen Receptor alpha (phospho S118) Antibody

Sign In for Pricing
View Details
Human Complement C3, C-His Tag
HA211092-01 Inquire

Human Complement C3, C-His Tag

Sign In for Pricing
View Details
Human Complement C3, C-His Tag
HA211092-02 100 µg

Human Complement C3, C-His Tag

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF568 conjugate, 0.1mg/mL
BNC682220-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/839), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details