Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GSTP1 protein

This Human GSTP1 protein spans the amino acid sequence from region 2-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST class-piGSTP1-1

UniProt

P09211

Expression Region

2-210aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM-3/HAVCR2 Polyclonal Antibody
E-AB-64640-01 60 µL

TIM-3/HAVCR2 Polyclonal Antibody

Sign In for Pricing
View Details
TIM-3/HAVCR2 Polyclonal Antibody
E-AB-64640-02 120 µL

TIM-3/HAVCR2 Polyclonal Antibody

Sign In for Pricing
View Details
TIM-3/HAVCR2 Polyclonal Antibody
E-AB-64640-03 200 µL

TIM-3/HAVCR2 Polyclonal Antibody

Sign In for Pricing
View Details
ELAPOR2 Human qPCR Primer Pair (NM_001142749)
HP230876 200 Reactions

ELAPOR2 Human qPCR Primer Pair (NM_001142749)

Sign In for Pricing
View Details
Vortex Mixer BVMX-104
BVMX-104 1 Unit

Vortex Mixer BVMX-104

Sign In for Pricing
View Details
HLA-DRB (MHC II) (DA2), CF488A conjugate, 0.1mg/mL
BNC882281-500 1x 500 µL

HLA-DRB (MHC II) (DA2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details