Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus L protein

This Virus L protein spans the amino acid sequence from region 625-809aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Large structural protein Replicase Transcriptase

UniProt

Q05318

Expression Region

625-809aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMS1/ASC Ready-To-Use IHC Kit
orb3001607 50 Tests

Human TMS1/ASC Ready-To-Use IHC Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 7 (FGF7) ELISA Kit
abx254075-01 96 Tests

Mouse Fibroblast Growth Factor 7 (FGF7) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 7 (FGF7) ELISA Kit
abx254075-02 5x 96 Tests

Mouse Fibroblast Growth Factor 7 (FGF7) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 7 (FGF7) ELISA Kit
abx254075-03 10x 96 Tests

Mouse Fibroblast Growth Factor 7 (FGF7) ELISA Kit

Sign In for Pricing
View Details
ASPN Western Blot kit (AWBK42487)
AWBK42487 10 Reactions

ASPN Western Blot kit (AWBK42487)

Sign In for Pricing
View Details
Human Gigaxonin (GAN) ELISA Kit
BSKH63573-01 48 Tests

Human Gigaxonin (GAN) ELISA Kit

Sign In for Pricing
View Details