Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP3 protein

This Human BMP3 protein spans the amino acid sequence from region 363-472aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone morphogenetic protein 3A , BMP-3AOsteogenin

UniProt

P12645

Expression Region

363-472aa

Tag

C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEBNext Ultra II End Repair/dA-Tailing Module
E7546S 24 Reactions

NEBNext Ultra II End Repair/dA-Tailing Module

Sign In for Pricing
View Details
ZFAND4 Protein Lysate
OCOA18605-20UG 20 µg

ZFAND4 Protein Lysate

Sign In for Pricing
View Details
Arrdc1 Rabbit Polyclonal Antibody
E53P02097 100 µL

Arrdc1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cldn27 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3352702 1.0 µg DNA

Cldn27 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
REAGENT RESERVOIR, for Robotic Pipettor, 96 Dimpled Depressions, Thicker Walls and Rounded Inside Corners to Prevent Reagents from Pooling, Includes Inlet/Outlet Ports for 1/4" ID, and 3/8" ID Tubing Fittings, on the Long Side, High and Low, SLAS Footprint, 48mm Height, Polypropylene
VP 530D-A 1 Each

REAGENT RESERVOIR, for Robotic Pipettor, 96 Dimpled Depressions, Thicker Walls and Rounded Inside Corners to Prevent Reagents from Pooling, Includes Inlet/Outlet Ports for 1/4" ID, and 3/8" ID Tubing Fittings, on the Long Side, High and Low, SLAS Footprint, 48mm Height, Polypropylene

Sign In for Pricing
View Details
Human High Density Lipoprotein Reconstituted Protein
abx060881 1 mg

Human High Density Lipoprotein Reconstituted Protein

Sign In for Pricing
View Details