Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP3 protein

This Human BMP3 protein spans the amino acid sequence from region 363-472aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone morphogenetic protein 3A , BMP-3AOsteogenin

UniProt

P12645

Expression Region

363-472aa

Tag

C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TH Antibody (C-term)
A01917-80ul 80 µL

Anti-TH Antibody (C-term)

Sign In for Pricing
View Details
Anti-ATP8/MT-ATP8 Antibody
A06405-1 100 µL

Anti-ATP8/MT-ATP8 Antibody

Sign In for Pricing
View Details
Anti-Density Regulated Protein  (1H3)
YF-MA16426 100 ug

Anti-Density Regulated Protein (1H3)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Interleukin 4 (IL4)
MBS2112708-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Interleukin 4 (IL4)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Interleukin 4 (IL4)
MBS2112708-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Interleukin 4 (IL4)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Interleukin 4 (IL4)
MBS2112708-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Interleukin 4 (IL4)

Sign In for Pricing
View Details