Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus isaB protein

This Virus isaB protein spans the amino acid sequence from region 37-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IsaB, Immunodominant staphylococcal antigen B

UniProt

Q9LAB5

Expression Region

37-175aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HE4 (WFDC2) (NM_006103) Human Recombinant Protein
TP750124 50 µg

HE4 (WFDC2) (NM_006103) Human Recombinant Protein

Sign In for Pricing
View Details
COX7B2 3'UTR Luciferase Stable Cell Line
TU004903 1.0 mL

COX7B2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
THT-1-728-10 Pre-sized Labels for Printers
132496 10000 Roll (10000 Label (s) x 1 Roll)

THT-1-728-10 Pre-sized Labels for Printers

Sign In for Pricing
View Details
Lentiviral human EN1 shRNA (UAS) - Lentiviral human EN1 shRNA (UAS, GFP) (25)
GTR15079940 1 Vial

Lentiviral human EN1 shRNA (UAS) - Lentiviral human EN1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
HDAC1 Peptide - C-terminal region (AAP31930)
AAP31930-100UG 100 µg

HDAC1 Peptide - C-terminal region (AAP31930)

Sign In for Pricing
View Details
Semaphorin 5A
MBS555929-01 0.1 mg

Semaphorin 5A

Sign In for Pricing
View Details