Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus isaB protein

This Virus isaB protein spans the amino acid sequence from region 37-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IsaB, Immunodominant staphylococcal antigen B

UniProt

Q9LAB5

Expression Region

37-175aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Procainamide Antibody
16701 100ug

Anti-Procainamide Antibody

Sign In for Pricing
View Details
CBR3 3'UTR Lenti-reporter-Luc Vector
15116081 1.0 µg

CBR3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Prap1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6883607 1.0 µg DNA

Prap1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Eif4ebp2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7416904 1.0 µg DNA

Eif4ebp2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Desmoglein-2 (DSG2) Antibody
orb1461366-01 20 µg

Desmoglein-2 (DSG2) Antibody

Sign In for Pricing
View Details
Desmoglein-2 (DSG2) Antibody
orb1461366-02 100 µg

Desmoglein-2 (DSG2) Antibody

Sign In for Pricing
View Details