Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Lgals4 protein

This Rat Lgals4 protein spans the amino acid sequence from region 1-324aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

L-36 lactose-binding protein Short name, L36LBP Lactose-binding lectin 4

UniProt

P38552

Expression Region

1-324aa

Tag

Tag-Free

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2AK1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
19074066 1.0 µg DNA

EIF2AK1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Hsa-miR-510-3p miRNA Mimic
orb1876691-01 5 nmol

Hsa-miR-510-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-510-3p miRNA Mimic
orb1876691-02 10 nmol

Hsa-miR-510-3p miRNA Mimic

Sign In for Pricing
View Details
COL4A1 Rabbit Polyclonal Antibody
E53P10971 100 µL

COL4A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bosentan Hydrate 500mg
A14944-500 500 mg

Bosentan Hydrate 500mg

Sign In for Pricing
View Details
Platelet Glycoprotein 4 (CD36) Antibody (Biotin)
abx337065-01 20 µg

Platelet Glycoprotein 4 (CD36) Antibody (Biotin)

Sign In for Pricing
View Details