Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Lgals4 protein

This Rat Lgals4 protein spans the amino acid sequence from region 1-324aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

L-36 lactose-binding protein Short name, L36LBP Lactose-binding lectin 4

UniProt

P38552

Expression Region

1-324aa

Tag

Tag-Free

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD59 shRNA Plasmid
abx950687-01 150 µg

Human CD59 shRNA Plasmid

Sign In for Pricing
View Details
Human CD59 shRNA Plasmid
abx950687-02 300 µg

Human CD59 shRNA Plasmid

Sign In for Pricing
View Details
Anti-CD31/PECAM-1 Antibody (9V319)
TMAY-00350 100 µL

Anti-CD31/PECAM-1 Antibody (9V319)

Sign In for Pricing
View Details
Itgb3bp Rat shRNA Lentiviral Particle (Locus ID 362548)
TL701951V 500 µL Each

Itgb3bp Rat shRNA Lentiviral Particle (Locus ID 362548)

Sign In for Pricing
View Details
BCL2A1, BH3 Domain Specific (BCL2A1, BCL2L5, BFL1, GRS, HBPA1, Bcl-2-related protein A1, Bcl-2-like protein 5, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS) (Azide free) (HRP) discontinued
032466-HRP 200 µL

BCL2A1, BH3 Domain Specific (BCL2A1, BCL2L5, BFL1, GRS, HBPA1, Bcl-2-related protein A1, Bcl-2-like protein 5, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
FANCM Antibody (C-Term)
E45R33374G-1 100 µL

FANCM Antibody (C-Term)

Sign In for Pricing
View Details