Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Milr1 protein

This Mouse Milr1 protein spans the amino acid sequence from region 34-150aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergy inhibitory receptor 1 Mast cell antigen 32 Short name, MCA-32 Short name, Mast cell Ag-32 Mast cell immunoglobulin-like receptor 1 Gm885, Mca32

UniProt

Q3TB92

Expression Region

34-150aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COMMD10, ID (COMMD10, COMM domain-containing protein 10) (APC) discontinued
034103-APC 200 µL

COMMD10, ID (COMMD10, COMM domain-containing protein 10) (APC) discontinued

Sign In for Pricing
View Details
PcDNA3.1-Flag-SALL2
PPL00373-2a 1 Each

PcDNA3.1-Flag-SALL2

Sign In for Pricing
View Details
WDR73, NT (WDR73, WD repeat-containing protein 73) (PE)
MBS6363411-01 0.2 mL

WDR73, NT (WDR73, WD repeat-containing protein 73) (PE)

Sign In for Pricing
View Details
WDR73, NT (WDR73, WD repeat-containing protein 73) (PE)
MBS6363411-02 5x 0.2 mL

WDR73, NT (WDR73, WD repeat-containing protein 73) (PE)

Sign In for Pricing
View Details
Rat C1h16orf54 Pre-designed siRNA Set A
SI201688A 1 Each

Rat C1h16orf54 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-CP110/CCP110 Antibody Picoband® (PE Conjugate)
A05058-1-PE 100 µg/Vial

Anti-CP110/CCP110 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details