Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria fno protein

This Bacteria fno protein spans the amino acid sequence from region 1-224aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F420H2, NADP oxidoreductase

UniProt

D9PVP5

Expression Region

1-224aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ UV540 maleimide
1608-AAT 1 mg

MFluor™ UV540 maleimide

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS801816 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
IREB2 (NM_004136) Human Over-expression Lysate
LY418191 100 µg

IREB2 (NM_004136) Human Over-expression Lysate

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF640R conjugate, 0.1mg/mL
BNC400011-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Automatic Slide Stainer BHTP-401
BHTP-401 1 Unit

Automatic Slide Stainer BHTP-401

Sign In for Pricing
View Details
(-)-Dihydroaflatoxin D2-d3
TRC-D495332-1MG 1 mg

(-)-Dihydroaflatoxin D2-d3

Sign In for Pricing
View Details