Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Haptoglobin protein

This Human Haptoglobin protein spans the amino acid sequence from region 19-406aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alternative name (s), Zonulin

UniProt

P00738

Expression Region

19-406aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm16387 3'UTR GFP Stable Cell Line
TU157735 1.0 mL

Gm16387 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AFX, phosphorylated (Ser197)
A0928-02 100 µg

AFX, phosphorylated (Ser197)

Sign In for Pricing
View Details
Hsp40, Hdj1 Antibody
MBS801262-01 0.1 mg

Hsp40, Hdj1 Antibody

Sign In for Pricing
View Details
Hsp40, Hdj1 Antibody
MBS801262-02 5x 0.1 mg

Hsp40, Hdj1 Antibody

Sign In for Pricing
View Details
F8A2 Antibody (N-term) Blocking peptide
MBS9218355-01 0.5 mg

F8A2 Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
F8A2 Antibody (N-term) Blocking peptide
MBS9218355-02 5x 0.5 mg

F8A2 Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details