Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIR2DS3 protein

This Human KIR2DS3 protein spans the amino acid sequence from region 22-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class I NK cell receptor Natural killer-associated transcript 7 Short name, NKAT-7 NKAT7

UniProt

Q14952

Expression Region

22-245aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAB21L2-set siRNA/shRNA/RNAi Lentivector (Human)
27878091 4x 500 ng

MAB21L2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
CD133 (PROM1) (NM_001145851) Human 3' UTR Clone
SC212895 10 µg

CD133 (PROM1) (NM_001145851) Human 3' UTR Clone

Sign In for Pricing
View Details
Anti-HPS5 antibody
STJ26694 100 µl

Anti-HPS5 antibody

Sign In for Pricing
View Details
HIF1A Polyclonal Antibody
MBS2562167-01 0.02 mL

HIF1A Polyclonal Antibody

Sign In for Pricing
View Details
HIF1A Polyclonal Antibody
MBS2562167-02 0.06 mL

HIF1A Polyclonal Antibody

Sign In for Pricing
View Details
HIF1A Polyclonal Antibody
MBS2562167-03 0.12 mL

HIF1A Polyclonal Antibody

Sign In for Pricing
View Details