Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-DMB protein

This Human HLA-DMB protein spans the amino acid sequence from region 19-218aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class II antigen DMB Really interesting new gene 7 protein DMB, RING7

UniProt

P28068

Expression Region

19-218aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF13B Polyclonal Antibody
MBS9234418-01 0.1 mL

KIF13B Polyclonal Antibody

Sign In for Pricing
View Details
KIF13B Polyclonal Antibody
MBS9234418-02 5x 0.1 mL

KIF13B Polyclonal Antibody

Sign In for Pricing
View Details
Nucleoplasmin 2 Rabbit Polyclonal Antibody (Biotin)
orb2441971 100 µL

Nucleoplasmin 2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
HSP90 beta Rabbit Polyclonal Antibody (BF594)
orb1589011 100 µL

HSP90 beta Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
PRAMEF7 Rabbit Polyclonal Antibody
orb327085 100 µL

PRAMEF7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human (CD9/CD81) Exosome Kit
SHE2204 100 Tests/Kit

Human (CD9/CD81) Exosome Kit

Sign In for Pricing
View Details