Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRDX1 protein

This Human PRDX1 protein spans the amino acid sequence from region 1-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Natural killer cell-enhancing factor A Proliferation-associated gene protein Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2

UniProt

Q06830

Expression Region

1-199aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc122 Mouse Gene Knockout Kit (CRISPR)
KN502646 1 Kit

Ccdc122 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-Annexin A1/ANXA1 Antibody Picoband® Fluoro647 Conjugated
PB9127-Fluoro647 100 µg/Vial

Anti-Annexin A1/ANXA1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Mouse Cmklr2 Pre-designed siRNA Set A
SI102770A 1 Each

Mouse Cmklr2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mtor Rat shRNA Plasmid (Locus ID 56718)
TR710387 1 Kit

Mtor Rat shRNA Plasmid (Locus ID 56718)

Sign In for Pricing
View Details
WDR57 Lentiviral Activation Particles (m)
sc-426088-LAC 200 µL

WDR57 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Rabbit Anti-ZNF350 antibody
SL12213R-01 50 µL

Rabbit Anti-ZNF350 antibody

Sign In for Pricing
View Details