Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VHL protein

This Human VHL protein spans the amino acid sequence from region 1-213aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein G7 pVHL

UniProt

P40337

Expression Region

1-213aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ALX4
Y058710 100 µg

Anti-ALX4

Sign In for Pricing
View Details
TGFBeta1 mouse Monoclonal Antibody(5D2)
JOT-MCA1202-01 50ul

TGFBeta1 mouse Monoclonal Antibody(5D2)

Sign In for Pricing
View Details
TGFBeta1 mouse Monoclonal Antibody(5D2)
JOT-MCA1202-02 100ul

TGFBeta1 mouse Monoclonal Antibody(5D2)

Sign In for Pricing
View Details
Anti-LRRK2/Dardarin, C-Terminus (N241A/34) Recombinant Chicken Chimeric mAb FL594 Conjugate
78-253-FL594 200 µL

Anti-LRRK2/Dardarin, C-Terminus (N241A/34) Recombinant Chicken Chimeric mAb FL594 Conjugate

Sign In for Pricing
View Details
Boc-4-benzoyl-D-phenylalanine 99+%
235998-01 250 mg

Boc-4-benzoyl-D-phenylalanine 99+%

Sign In for Pricing
View Details
Boc-4-benzoyl-D-phenylalanine 99+%
235998-02 1 g

Boc-4-benzoyl-D-phenylalanine 99+%

Sign In for Pricing
View Details