Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria cry1Fb protein

This Bacteria cry1Fb protein spans the amino acid sequence from region 984-1169aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

132 kDa crystal protein Crystaline entomocidal protoxin Insecticidal delta-endotoxin CryIF (b) cryIF (b), cryINA67-1

UniProt

O66377

Expression Region

984-1169aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bacillus thuringiensis subsp. Morrisoni

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CCL2/MCP-1 Protein
MBS9146936-01 0.01 mg

Recombinant Human CCL2/MCP-1 Protein

Sign In for Pricing
View Details
Recombinant Human CCL2/MCP-1 Protein
MBS9146936-02 0.02 mg

Recombinant Human CCL2/MCP-1 Protein

Sign In for Pricing
View Details
Recombinant Human CCL2/MCP-1 Protein
MBS9146936-03 0.05 mg

Recombinant Human CCL2/MCP-1 Protein

Sign In for Pricing
View Details
Recombinant Human CCL2/MCP-1 Protein
MBS9146936-04 5x 0.05 mg

Recombinant Human CCL2/MCP-1 Protein

Sign In for Pricing
View Details
Lentiviral mouse Trappc13 shRNA (UAS) - Lentiviral mouse Trappc13 shRNA (UAS) (25)
GTR15305084 1 Vial

Lentiviral mouse Trappc13 shRNA (UAS) - Lentiviral mouse Trappc13 shRNA (UAS) (25)

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 3 (SLC16A3) Magnetic Fluorescence Assay Kit
MBS2159804-01 96 Tests

Solute Carrier Family 16, Member 3 (SLC16A3) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details