Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL3 protein

This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-3; IL-3; Hematopoietic growth factor; Mast cell growth factor (MCGF) ; Multipotential colony-stimulating factor; P-cell-stimulating factor; IL3

UniProt

P08700

Expression Region

20-152aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL.

Form

Lyophilized powder

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rnaset2a shRNA (UAS) - Lentiviral mouse Rnaset2a shRNA (UAS) (25)
GTR15235517 1 Vial

Lentiviral mouse Rnaset2a shRNA (UAS) - Lentiviral mouse Rnaset2a shRNA (UAS) (25)

Sign In for Pricing
View Details
PE anti-human CD158e1
FC0597 100 Tests

PE anti-human CD158e1

Sign In for Pricing
View Details
CCDC158 shRNA Plasmid (m)
sc-140244-SH 20 µg

CCDC158 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Hspb2 ELISA Kit
EF015137 96 Tests

Mouse Hspb2 ELISA Kit

Sign In for Pricing
View Details
Claudin 3, 4, 6, 9 Rabbit Polyclonal Antibody (BF594)
orb2434596 100 µL

Claudin 3, 4, 6, 9 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Rat Tmbim7 Pre-designed siRNA Set B
SI214631B 1 Each

Rat Tmbim7 Pre-designed siRNA Set B

Sign In for Pricing
View Details