Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL3 protein

This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-3; IL-3; Hematopoietic growth factor; Mast cell growth factor (MCGF) ; Multipotential colony-stimulating factor; P-cell-stimulating factor; IL3

UniProt

P08700

Expression Region

20-152aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL.

Form

Lyophilized powder

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSN Rabbit Polyclonal Antibody (Fluoro488)
orb3109688 100 µg

TSN Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Recombinant Plantago lanceolata Major pollen allergen Pla l 1
AP73911-01 20 µg

Recombinant Plantago lanceolata Major pollen allergen Pla l 1

Sign In for Pricing
View Details
Recombinant Plantago lanceolata Major pollen allergen Pla l 1
AP73911-02 100 µg

Recombinant Plantago lanceolata Major pollen allergen Pla l 1

Sign In for Pricing
View Details
Recombinant Plantago lanceolata Major pollen allergen Pla l 1
AP73911-03 1 mg

Recombinant Plantago lanceolata Major pollen allergen Pla l 1

Sign In for Pricing
View Details
Anti-OVGP1 Antibody (N-Term)
M07911-01 50 µL

Anti-OVGP1 Antibody (N-Term)

Sign In for Pricing
View Details
Anti-OVGP1 Antibody (N-Term)
M07911-02 200 µL

Anti-OVGP1 Antibody (N-Term)

Sign In for Pricing
View Details