Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL3 protein

This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-3; IL-3; Hematopoietic growth factor; Mast cell growth factor (MCGF) ; Multipotential colony-stimulating factor; P-cell-stimulating factor; IL3

UniProt

P08700

Expression Region

20-152aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL.

Form

Lyophilized powder

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F3 Antibody FITC-Conjugated
MBS541455-01 0.1 mg

E2F3 Antibody FITC-Conjugated

Sign In for Pricing
View Details
E2F3 Antibody FITC-Conjugated
MBS541455-02 5x 0.1 mg

E2F3 Antibody FITC-Conjugated

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa PLES_32121 Protein (aa 1-265)
VAng-Cr0599-1mgEcoli 1 mg (E. coli)

Recombinant Pseudomonas Aeruginosa PLES_32121 Protein (aa 1-265)

Sign In for Pricing
View Details
ELAVL2 Polyclonal Antibody
RD79117A-01 20 µL

ELAVL2 Polyclonal Antibody

Sign In for Pricing
View Details
ELAVL2 Polyclonal Antibody
RD79117A-02 60 μL

ELAVL2 Polyclonal Antibody

Sign In for Pricing
View Details
ELAVL2 Polyclonal Antibody
RD79117A-03 120 μL

ELAVL2 Polyclonal Antibody

Sign In for Pricing
View Details