Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lta protein

This Mouse Lta protein spans the amino acid sequence from region 34-202aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TNF-beta Tumor necrosis factor ligand superfamily member 1 Tnfb, Tnfsf1

UniProt

P09225

Expression Region

34-202aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)
MBS2109886-01 0.1 mL

FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)
MBS2109886-02 0.2 mL

FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)
MBS2109886-03 0.5 mL

FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)
MBS2109886-04 1 mL

FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)
MBS2109886-05 5 mL

FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)
MBS2109886-06 5x 5 mL

FITC-Linked Monoclonal Antibody to Syntenin 2 (ST2)

Sign In for Pricing
View Details