Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate GHR protein

This Primate GHR protein spans the amino acid sequence from region 19-264aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Somatotropin receptor

UniProt

P79194

Expression Region

19-264aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATS2 Rabbit Polyclonal Antibody (BF555)
orb2488048 100 µL

SPATS2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Poteg 3'UTR Luciferase Stable Cell Line
TU216569 1.0 mL

Poteg 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C18orf32 Antibody (C-Term)
MBS9216904-01 0.05 mL

C18orf32 Antibody (C-Term)

Sign In for Pricing
View Details
C18orf32 Antibody (C-Term)
MBS9216904-02 5x 0.05 mL

C18orf32 Antibody (C-Term)

Sign In for Pricing
View Details
Recombinant Mouse IL-36B (HEK293-expressed , His Tag)
OM770109-01 2 μg

Recombinant Mouse IL-36B (HEK293-expressed , His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-36B (HEK293-expressed , His Tag)
OM770109-02 10 μg

Recombinant Mouse IL-36B (HEK293-expressed , His Tag)

Sign In for Pricing
View Details