Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cr2 protein

This Mouse Cr2 protein spans the amino acid sequence from region 12-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complement C3d receptor CD_antigen, CD21

UniProt

P19070

Expression Region

12-140aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEL Like Protein 2 (NELL2) Magnetic Fluorescence Assay Kit
MBS2161492-01 96 Tests

NEL Like Protein 2 (NELL2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
NEL Like Protein 2 (NELL2) Magnetic Fluorescence Assay Kit
MBS2161492-02 5x 96 Tests

NEL Like Protein 2 (NELL2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
NEL Like Protein 2 (NELL2) Magnetic Fluorescence Assay Kit
MBS2161492-03 10x 96 Tests

NEL Like Protein 2 (NELL2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
GPSM2 Antibody
orb19420 100 µg

GPSM2 Antibody

Sign In for Pricing
View Details
GNB2 Rabbit pAb, BF700 conjugated
orb2824779 100 µL

GNB2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Human Peptidyl Arginine Deiminase Type II (PADI2) ELISA Kit
MBS2000074-01 24 Strip Well

Human Peptidyl Arginine Deiminase Type II (PADI2) ELISA Kit

Sign In for Pricing
View Details