Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli btuF protein

This E. coli btuF protein spans the amino acid sequence from region 24-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BtuF, yadT, b0158, JW0154Vitamin B12-binding protein

UniProt

P37028

Expression Region

24-266aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Panobacumab Biosimilar (Monoclonal, IgM-kappa)
A135272 100 µL

Panobacumab Biosimilar (Monoclonal, IgM-kappa)

Sign In for Pricing
View Details
Lamin B2 antibody
MBS9404202-01 0.1 mL

Lamin B2 antibody

Sign In for Pricing
View Details
Lamin B2 antibody
MBS9404202-02 5x 0.1 mL

Lamin B2 antibody

Sign In for Pricing
View Details
CST7 Protein Vector (Human) (pPM-C-HA)
PV010979 500 ng

CST7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Cwc22 shRNA (UAS) - Lentiviral mouse Cwc22 shRNA (UAS, GFP) plasmid
GTR15146998 1 Vial

Lentiviral mouse Cwc22 shRNA (UAS) - Lentiviral mouse Cwc22 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial
CSB-EP867765RMS-01 20 µg

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

Sign In for Pricing
View Details