Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GSTP1 protein

This Human GSTP1 protein spans the amino acid sequence from region 2-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST class-piGSTP1-1

UniProt

P09211

Expression Region

2-210aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isobarbituric Acid
TRC-I780030-500MG 500 mg

Isobarbituric Acid

Sign In for Pricing
View Details
Mouse Cyba activation kit by CRISPRa
GA200963 1 Kit

Mouse Cyba activation kit by CRISPRa

Sign In for Pricing
View Details
THOP1 Antibody
KC-3491-01 50 μL

THOP1 Antibody

Sign In for Pricing
View Details
THOP1 Antibody
KC-3491-02 100 µL

THOP1 Antibody

Sign In for Pricing
View Details
THOP1 Antibody
KC-3491-03 1 mL

THOP1 Antibody

Sign In for Pricing
View Details
PPHLN1 (NM_201438) Human Recombinant Protein
TP308045 20 µg

PPHLN1 (NM_201438) Human Recombinant Protein

Sign In for Pricing
View Details