Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTGF protein

This Human CTGF protein spans the amino acid sequence from region 253-349aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8 , IBP-8 , IGF-binding protein 8 , IGFBP-8

UniProt

P29279

Expression Region

253-349aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Gremlin 1 (GREM1)
TRV-0024000-01 200 µL

FITC-Linked Polyclonal Antibody to Gremlin 1 (GREM1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Gremlin 1 (GREM1)
TRV-0024000-02 1 mL

FITC-Linked Polyclonal Antibody to Gremlin 1 (GREM1)

Sign In for Pricing
View Details
Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein
PKSH033151-01 10 µg

Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein

Sign In for Pricing
View Details
Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein
PKSH033151-02 50 µg

Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein

Sign In for Pricing
View Details
PKR1 Peptide
DF5144-BP 1 mg

PKR1 Peptide

Sign In for Pricing
View Details
Coronaric acid
HY-W749980 1 mg (6.75 mM x 500 μL in Ethanol)

Coronaric acid

Sign In for Pricing
View Details