Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli rpmA protein

This E. coli rpmA protein spans the amino acid sequence from region 2-85aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpmA, b3185, JW3152, 50S ribosomal protein L27, Large ribosomal subunit protein bL27

UniProt

P0A7L8

Expression Region

2-85aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45R Antibody [RA3-6B2], Rat IgG2a
24-598 0.2 mg

CD45R Antibody [RA3-6B2], Rat IgG2a

Sign In for Pricing
View Details
SP3 (Transcription Factor Sp3, SPR-2, DKFZp686O1631) discontinued
133736 100 µg

SP3 (Transcription Factor Sp3, SPR-2, DKFZp686O1631) discontinued

Sign In for Pricing
View Details
Recombinant Human BTN1A1 Protein (Biotin)
orb2993777-01 20 µg

Recombinant Human BTN1A1 Protein (Biotin)

Sign In for Pricing
View Details
Recombinant Human BTN1A1 Protein (Biotin)
orb2993777-02 100 µg

Recombinant Human BTN1A1 Protein (Biotin)

Sign In for Pricing
View Details
TIAL1 Rabbit Polyclonal Antibody
TA330340 100 µL

TIAL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR12 Conjugated Antibody
orb1615758 100 µL

GPR12 Conjugated Antibody

Sign In for Pricing
View Details