Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli rpmA protein

This E. coli rpmA protein spans the amino acid sequence from region 2-85aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpmA, b3185, JW3152, 50S ribosomal protein L27, Large ribosomal subunit protein bL27

UniProt

P0A7L8

Expression Region

2-85aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNV1, NT (KCNV1, Potassium voltage-gated channel subfamily V member 1, Neuronal potassium channel alpha subunit HNKA, Voltage-gated potassium channel subunit Kv8.1) (MaxLight 405)
MBS6312780-01 0.1 mL

KCNV1, NT (KCNV1, Potassium voltage-gated channel subfamily V member 1, Neuronal potassium channel alpha subunit HNKA, Voltage-gated potassium channel subunit Kv8.1) (MaxLight 405)

Sign In for Pricing
View Details
KCNV1, NT (KCNV1, Potassium voltage-gated channel subfamily V member 1, Neuronal potassium channel alpha subunit HNKA, Voltage-gated potassium channel subunit Kv8.1) (MaxLight 405)
MBS6312780-02 5x 0.1 mL

KCNV1, NT (KCNV1, Potassium voltage-gated channel subfamily V member 1, Neuronal potassium channel alpha subunit HNKA, Voltage-gated potassium channel subunit Kv8.1) (MaxLight 405)

Sign In for Pricing
View Details
1-Bromo-1-fluoroethene
PC9606 5 g

1-Bromo-1-fluoroethene

Sign In for Pricing
View Details
LOC685203 3'UTR Luciferase Stable Cell Line
TU211198 1.0 mL

LOC685203 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ARL6 (ADP-Ribosylation Factor-like Protein 6, Bardet-Biedl Syndrome 3 Protein, ARL6, BBS3) (APC) discontinued
302273-APC 200 µL

ARL6 (ADP-Ribosylation Factor-like Protein 6, Bardet-Biedl Syndrome 3 Protein, ARL6, BBS3) (APC) discontinued

Sign In for Pricing
View Details
Rat Keratin 1 (KRT1) ELISA Kit
abx155758-01 96 Tests

Rat Keratin 1 (KRT1) ELISA Kit

Sign In for Pricing
View Details