Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MPZ protein

This Human MPZ protein spans the amino acid sequence from region 30-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelin peripheral protein , MPPMyelin protein zero

UniProt

P25189

Expression Region

30-156aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANT3 discontinued
533071-01 30ul

ANT3 discontinued

Sign In for Pricing
View Details
ANT3 discontinued
533071-02 100 µL

ANT3 discontinued

Sign In for Pricing
View Details
Recombinant Human RXR gamma/NR2B3 Protein - (Dry Ice)
H00006258-Q01-10ug 10 µg

Recombinant Human RXR gamma/NR2B3 Protein - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Rho GTPase-activating protein 12 (ARHGAP12), partial
MBS1337592 Inquire

Recombinant Macaca fascicularis Rho GTPase-activating protein 12 (ARHGAP12), partial

Sign In for Pricing
View Details
SCN2A Rabbit Polyclonal Antibody (BF750)
orb2475181 100 µL

SCN2A Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
GSDME Rabbit mAb
orb1564991-01 20 ul

GSDME Rabbit mAb

Sign In for Pricing
View Details