Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MPZ protein

This Human MPZ protein spans the amino acid sequence from region 30-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelin peripheral protein , MPPMyelin protein zero

UniProt

P25189

Expression Region

30-156aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKS3 Antibody - N-terminal region : HRP (ARP52561_P050-HRP)
ARP52561_P050-HRP 100 µL

ANKS3 Antibody - N-terminal region : HRP (ARP52561_P050-HRP)

Sign In for Pricing
View Details
SYVN1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
46016064 1.0 µg DNA

SYVN1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TRIM15 Protein Vector (Mouse) (pPB-C-His)
PV241422 500 ng

TRIM15 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
2,​3,​4-​Tri-​O-​acetyl-​β-​L-​fucopyranosyl azide
C51686-1G 1 Unit

2,​3,​4-​Tri-​O-​acetyl-​β-​L-​fucopyranosyl azide

Sign In for Pricing
View Details
Cattle Zn-MT (Zn-Metallothionein) ELISA Kit
EK250090 96 Well

Cattle Zn-MT (Zn-Metallothionein) ELISA Kit

Sign In for Pricing
View Details
APOH Rabbit Polyclonal Antibody (HRP)
orb469834 100 µL

APOH Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details