Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Interferon gamma protein

This Human Interferon gamma protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

10KDA interferon gamma-induced protein , Gamma-IP10 , IP-10Small-inducible cytokine B10

UniProt

P02778

Expression Region

22-98aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK4 Rabbit pAb
E45R18553N 50 ul

PAK4 Rabbit pAb

Sign In for Pricing
View Details
Anti-FABP-1/GOT2 Antibody Picoband®, HRP Conjugate
A05998-1-HRP 100 µg/Vial

Anti-FABP-1/GOT2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
AXUD1 Polyclonal Antibody, Cy3 Conjugated
bs-7696R-Cy3 100 µL

AXUD1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
NONO Mouse Monoclonal Antibody [Clone ID: OTI4D9]
CF504777 100 µg

NONO Mouse Monoclonal Antibody [Clone ID: OTI4D9]

Sign In for Pricing
View Details
Withanolide A
sc-475053 5 mg

Withanolide A

Sign In for Pricing
View Details
NAT16 (N-Term) Rabbit pAb
E2619605 100 µL

NAT16 (N-Term) Rabbit pAb

Sign In for Pricing
View Details