Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Interferon gamma protein

This Human Interferon gamma protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

10KDA interferon gamma-induced protein , Gamma-IP10 , IP-10Small-inducible cytokine B10

UniProt

P02778

Expression Region

22-98aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ng23 Recombinant Protein (Rat)
RP213863 100 µg

Ng23 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Canine Calpain 12 (CAPN12) ELISA Kit
GTR10319849 96 Well

Canine Calpain 12 (CAPN12) ELISA Kit

Sign In for Pricing
View Details
CD2 Monoclonal Antibody, RBITC Conjugated
bsm-63073R-RBITC 100 µL

CD2 Monoclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Rat Fmn2 Pre-designed siRNA Set A
SI205141A 1 Each

Rat Fmn2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human Tissue Factor Pathway Inhibitor 2/TFPI-2/PP5/REF-1 (C-6His)
C390-50ug 50 µg

Recombinant Human Tissue Factor Pathway Inhibitor 2/TFPI-2/PP5/REF-1 (C-6His)

Sign In for Pricing
View Details
Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (MaxLight 750) discontinued
143571-ML750 100 µL

Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (MaxLight 750) discontinued

Sign In for Pricing
View Details