Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BDNF protein

This Human BDNF protein spans the amino acid sequence from region 137-237aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Abrineurin

UniProt

P23560

Expression Region

137-237aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHLB1, CT (Protein LL5-alpha, Pleckstrin homology-like domain family B member 1,DLNB07, LL5A, KIAA0638, PHLDB1) (MaxLight 750)
MBS6333418-01 0.1 mL

PHLB1, CT (Protein LL5-alpha, Pleckstrin homology-like domain family B member 1,DLNB07, LL5A, KIAA0638, PHLDB1) (MaxLight 750)

Sign In for Pricing
View Details
PHLB1, CT (Protein LL5-alpha, Pleckstrin homology-like domain family B member 1,DLNB07, LL5A, KIAA0638, PHLDB1) (MaxLight 750)
MBS6333418-02 5x 0.1 mL

PHLB1, CT (Protein LL5-alpha, Pleckstrin homology-like domain family B member 1,DLNB07, LL5A, KIAA0638, PHLDB1) (MaxLight 750)

Sign In for Pricing
View Details
NRGN Antibody
MBS8588900-01 0.1 mg

NRGN Antibody

Sign In for Pricing
View Details
NRGN Antibody
MBS8588900-02 0.1 mL (AF405L)

NRGN Antibody

Sign In for Pricing
View Details
NRGN Antibody
MBS8588900-03 0.1 mL (AF405S)

NRGN Antibody

Sign In for Pricing
View Details
NRGN Antibody
MBS8588900-04 0.1 mL (AF610)

NRGN Antibody

Sign In for Pricing
View Details