Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SAT1 protein

This Human SAT1 protein spans the amino acid sequence from region 5-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Polyamine N-acetyltransferase 1, Putrescine acetyltransferase, Spermidine/spermine N (1) -acetyltransferase 1 , SSAT , SSAT-1

UniProt

P21673

Expression Region

5-171aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Complement Component 3B ELISA Kit
MBS031255-01 48 Well

Porcine Complement Component 3B ELISA Kit

Sign In for Pricing
View Details
Porcine Complement Component 3B ELISA Kit
MBS031255-02 96 Well

Porcine Complement Component 3B ELISA Kit

Sign In for Pricing
View Details
Porcine Complement Component 3B ELISA Kit
MBS031255-03 5x 96 Well

Porcine Complement Component 3B ELISA Kit

Sign In for Pricing
View Details
Porcine Complement Component 3B ELISA Kit
MBS031255-04 10x 96 Well

Porcine Complement Component 3B ELISA Kit

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Pericentriolar Material 1 (PCM1)
MBS2094809-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Pericentriolar Material 1 (PCM1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Pericentriolar Material 1 (PCM1)
MBS2094809-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Pericentriolar Material 1 (PCM1)

Sign In for Pricing
View Details