Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SAT1 protein

This Human SAT1 protein spans the amino acid sequence from region 5-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Polyamine N-acetyltransferase 1, Putrescine acetyltransferase, Spermidine/spermine N (1) -acetyltransferase 1 , SSAT , SSAT-1

UniProt

P21673

Expression Region

5-171aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rilpl2 3'UTR Luciferase Stable Cell Line
TU219440 1.0 mL

Rilpl2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TXNIP Rabbit Polyclonal Antibody (BF350)
orb1600624 100 µL

TXNIP Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
RABIF Antibody
MBS7005435-01 0.05 mg

RABIF Antibody

Sign In for Pricing
View Details
RABIF Antibody
MBS7005435-02 0.1 mg

RABIF Antibody

Sign In for Pricing
View Details
RABIF Antibody
MBS7005435-03 5x 0.1 mg

RABIF Antibody

Sign In for Pricing
View Details
MELAS 3'UTR Luciferase Stable Cell Line
TU013224 1.0 mL

MELAS 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details