Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SAT1 protein

This Human SAT1 protein spans the amino acid sequence from region 5-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Polyamine N-acetyltransferase 1, Putrescine acetyltransferase, Spermidine/spermine N (1) -acetyltransferase 1 , SSAT , SSAT-1

UniProt

P21673

Expression Region

5-171aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish FLT1 Antibody Picoband® FITC Conjugated
AZB3DKP1-FITC 100 µg/Vial

Anti-Zebrafish FLT1 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Human MAPRE1 Recombinant Protein
PROTQ15691-20ug 20 µg

Human MAPRE1 Recombinant Protein

Sign In for Pricing
View Details
WDHD1 Blocking Peptide
CBP2535-01 1 mg

WDHD1 Blocking Peptide

Sign In for Pricing
View Details
WDHD1 Blocking Peptide
CBP2535-02 5 mg

WDHD1 Blocking Peptide

Sign In for Pricing
View Details
LIF, Mouse
MBS8575391-01 0.005 mg

LIF, Mouse

Sign In for Pricing
View Details
LIF, Mouse
MBS8575391-02 5x 0.005 mg

LIF, Mouse

Sign In for Pricing
View Details