Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Efna1 protein

This Rat Efna1 protein spans the amino acid sequence from region 18-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPH-related receptor tyrosine kinase ligand 1 , LERK-1Immediate early response protein B61

UniProt

P97553

Expression Region

18-182aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PMCA1 Rabbit Monoclonal Antibody
M02669 100 µL/Vial

Anti-PMCA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD27
309791-01 50 µL

CD27

Sign In for Pricing
View Details
CD27
309791-02 100 µL

CD27

Sign In for Pricing
View Details
LAMP1 Recombinant Rabbit mAb, Cy3 conjugated
orb3000110 100 µL

LAMP1 Recombinant Rabbit mAb, Cy3 conjugated

Sign In for Pricing
View Details
PACSIN3, NT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 3, SH3 Domain-containing Protein 6511, Endophilin I) (APC) discontinued
P1793-10A-APC 200 µL

PACSIN3, NT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 3, SH3 Domain-containing Protein 6511, Endophilin I) (APC) discontinued

Sign In for Pricing
View Details
VTN Rabbit Polyclonal Antibody (FITC)
orb2100528 100 µL

VTN Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details