Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Efna1 protein

This Rat Efna1 protein spans the amino acid sequence from region 18-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPH-related receptor tyrosine kinase ligand 1 , LERK-1Immediate early response protein B61

UniProt

P97553

Expression Region

18-182aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD142/F3/TF Protein, C-His
orb2836397-01 20 µg

Recombinant Human CD142/F3/TF Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD142/F3/TF Protein, C-His
orb2836397-02 50 µg

Recombinant Human CD142/F3/TF Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD142/F3/TF Protein, C-His
orb2836397-03 100 µg

Recombinant Human CD142/F3/TF Protein, C-His

Sign In for Pricing
View Details
AHSA1 Antibody, FITC conjugated
CSB-PA05455C0Rb-01 50 µg

AHSA1 Antibody, FITC conjugated

Sign In for Pricing
View Details
AHSA1 Antibody, FITC conjugated
CSB-PA05455C0Rb-02 100 µg

AHSA1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica psd Protein (aa 1-253) (strain 8081)
VAng-Cr2165-1mgEcoli 1 mg (E. coli)

Recombinant Yersinia Enterocolitica psd Protein (aa 1-253) (strain 8081)

Sign In for Pricing
View Details