Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Efna1 protein

This Rat Efna1 protein spans the amino acid sequence from region 18-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPH-related receptor tyrosine kinase ligand 1 , LERK-1Immediate early response protein B61

UniProt

P97553

Expression Region

18-182aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYSMD1 CRISPR Activation Plasmid (h)
sc-409108-ACT 20 µg

LYSMD1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
2,5-Norbornadiene Palladium (II) Dichloride
MAA31746-01 5000 mg

2,5-Norbornadiene Palladium (II) Dichloride

Sign In for Pricing
View Details
2,5-Norbornadiene Palladium (II) Dichloride
MAA31746-02 10000 mg

2,5-Norbornadiene Palladium (II) Dichloride

Sign In for Pricing
View Details
Genorise® Mouse Tail DNA Extraction Kit 200
GR101050 200 Preparations

Genorise® Mouse Tail DNA Extraction Kit 200

Sign In for Pricing
View Details
MIR199a Rat qPCR Primer Pair (MI0000941)
RP300097 200 Reactions

MIR199a Rat qPCR Primer Pair (MI0000941)

Sign In for Pricing
View Details
2-fluoro-3- (methylthio) -6- (trifluoromethyl) pyridine
PC1018886-01 250 mg

2-fluoro-3- (methylthio) -6- (trifluoromethyl) pyridine

Sign In for Pricing
View Details