Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF1 protein

This Human FGF1 protein spans the amino acid sequence from region 1-155aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FGF-1, aFGF, Endothelial cell growth factor, ECGF, Heparin-binding growth factor 1

UniProt

P05230

Expression Region

1-155aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg in the presence of 10 μg/ml of heparin.

Form

Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-155aaSequence Info: Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, with 2 mM EDTA, 0.5 mM DTT, 5 % Trehalose

AA Sequence

AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)
MBS2041229-01 0.1 mL

FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)
MBS2041229-02 0.2 mL

FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)
MBS2041229-03 0.5 mL

FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)
MBS2041229-04 1 mL

FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)
MBS2041229-05 5 mL

FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)
MBS2041229-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Cathepsin A (CTSA)

Sign In for Pricing
View Details