Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LOX protein

This Human LOX protein spans the amino acid sequence from region 169-417aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lysyl oxidase

UniProt

P28300

Expression Region

169-417aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-taggedExpression Region: 169-417aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella baltica GTPase Der (der)
MBS1207092-01 0.02 mg (E-Coli)

Recombinant Shewanella baltica GTPase Der (der)

Sign In for Pricing
View Details
Recombinant Shewanella baltica GTPase Der (der)
MBS1207092-02 0.02 mg (Yeast)

Recombinant Shewanella baltica GTPase Der (der)

Sign In for Pricing
View Details
Recombinant Shewanella baltica GTPase Der (der)
MBS1207092-03 0.1 mg (E-Coli)

Recombinant Shewanella baltica GTPase Der (der)

Sign In for Pricing
View Details
Recombinant Shewanella baltica GTPase Der (der)
MBS1207092-04 0.1 mg (Yeast)

Recombinant Shewanella baltica GTPase Der (der)

Sign In for Pricing
View Details
Recombinant Shewanella baltica GTPase Der (der)
MBS1207092-05 0.02 mg (Baculovirus)

Recombinant Shewanella baltica GTPase Der (der)

Sign In for Pricing
View Details
Recombinant Shewanella baltica GTPase Der (der)
MBS1207092-06 0.02 mg (Mammalian-Cell)

Recombinant Shewanella baltica GTPase Der (der)

Sign In for Pricing
View Details