Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial APT protein

This Bacterial APT protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apt, SPy_0927, M5005_Spy0728Adenine phosphoribosyltransferase, APRT, EC 2.4.2.7

UniProt

P63546

Expression Region

1-172aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Streptococcus pyogenes serotype M1

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-172aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL9 (C-X-C motif chemokine 9) ELISA Kit
EH0008 96 Tests

Human CXCL9 (C-X-C motif chemokine 9) ELISA Kit

Sign In for Pricing
View Details
RGD1309922 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
39087156 3x 1.0 µg DNA

RGD1309922 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
EGFL7 (Epidermal Growth Factor-like Protein 7, EGF-like Protein 7, Multiple Epidermal Growth Factor-like Domains Protein 7, Multiple EGF-like Domains Protein 7, NOTCH4-like Protein, Vascular Endothelial Statin, VE-statin, Zneu1, MEGF7, UNQ187/PRO1449, MGC
MBS6377064-01 0.1 mL

EGFL7 (Epidermal Growth Factor-like Protein 7, EGF-like Protein 7, Multiple Epidermal Growth Factor-like Domains Protein 7, Multiple EGF-like Domains Protein 7, NOTCH4-like Protein, Vascular Endothelial Statin, VE-statin, Zneu1, MEGF7, UNQ187/PRO1449, MGC

Sign In for Pricing
View Details
EGFL7 (Epidermal Growth Factor-like Protein 7, EGF-like Protein 7, Multiple Epidermal Growth Factor-like Domains Protein 7, Multiple EGF-like Domains Protein 7, NOTCH4-like Protein, Vascular Endothelial Statin, VE-statin, Zneu1, MEGF7, UNQ187/PRO1449, MGC
MBS6377064-02 5x 0.1 mL

EGFL7 (Epidermal Growth Factor-like Protein 7, EGF-like Protein 7, Multiple Epidermal Growth Factor-like Domains Protein 7, Multiple EGF-like Domains Protein 7, NOTCH4-like Protein, Vascular Endothelial Statin, VE-statin, Zneu1, MEGF7, UNQ187/PRO1449, MGC

Sign In for Pricing
View Details
EFHA1 Rabbit Polyclonal Antibody
orb511808 100 µg

EFHA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARMCX3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
12421124 3x 1.0µg DNA

ARMCX3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details